Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Protein translocase subunit SecF (secF)

This Recombinant Haemophilus influenzae Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-325.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

P44590

Expression Region

1-325

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMKLFTKDKDGHFIREINGIKLPFPLTEFMKVRKLGYILSALLMVISLFFIITKGFNWGL DFTGGVVFDTHFSQSANLEQIRSKLHENGIESPIVQTTGSVQDVMIRLPASNNDSTIGEH VKSMLQNVDKDIQIRSIEFVGPNVGEELAQGAVYATLATLAMVLIYVGSRFEWRLGFGSI ASLAHDVIITLGVFSALQIEIDLTFVAAILSVVGYSINDSIVVFDRVRENFRKIRRLDTI DIIDISLTQTLSRTIITSVTTLVVVMALFFFGGPSIHNFSLALLVGIGFGTYSSIFVAIA IAYDVGLRREHMIPPKVDKEIDELP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF488A conjugate, 0.1mg/mL
BNC882697-100 1x 100 µL

PMEPA1 / TMEPAI (Tumor Suppressor Oncoprotein) (PMEPA1/2697), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL13 receptor alpha 2 (IL13RA2) (NM_000640) Human Over-expression Lysate
LC424589 20 µg

IL13 receptor alpha 2 (IL13RA2) (NM_000640) Human Over-expression Lysate

Sign In for Pricing
View Details
MitoViewTM 633, Trial Size
#70055-T 1x 50 µg

MitoViewTM 633, Trial Size

Sign In for Pricing
View Details
Human VCAM-1 / CD106, C-His Tag
HA210976-01 Inquire

Human VCAM-1 / CD106, C-His Tag

Sign In for Pricing
View Details
Human VCAM-1 / CD106, C-His Tag
HA210976-02 50 µg

Human VCAM-1 / CD106, C-His Tag

Sign In for Pricing
View Details
Human VCAM-1 / CD106, C-His Tag
HA210976-03 100 µg

Human VCAM-1 / CD106, C-His Tag

Sign In for Pricing
View Details