Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-2 (srg-2)

This Recombinant Serpentine receptor class gamma-2 (srg-2) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-2, Protein srg-2

UniProt

P46571

Expression Region

1-327

Origin

Caenorhabditis elegans

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSSTAPLSIITKLALFERTCDSSYSPLAENLKYLVQFVYLLPAAMLHARILYILLWKHR NLYLKQSFYILFIMSCIACFTLVVQDIFFARVFQYMTQFCEPMSEFVENYPIFPAIYYPL QQHLHCAQPIIQILLTVNRMSCVVIPWKHSQVWKSFMKYAIALVILTPFLFIWNIIISKK LPVYTFGGFYIGYERVVIWATMTLFMLILRAITIVITAVCTFITVLRLTRMSKRLVSSER TLCIASFLISSCFLGTAAAESLFAFQVVRTSTSISYFLLPISWDILNVGTPIVMVMASSQ LRRHVFGILKRSRSNSRVEDGTIVTGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEC2 Polyclonal Antibody
E-AB-19007-01 20 µL

MAGEC2 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEC2 Polyclonal Antibody
E-AB-19007-02 60 µL

MAGEC2 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEC2 Polyclonal Antibody
E-AB-19007-03 120 µL

MAGEC2 Polyclonal Antibody

Sign In for Pricing
View Details
MAGEC2 Polyclonal Antibody
E-AB-19007-04 200 µL

MAGEC2 Polyclonal Antibody

Sign In for Pricing
View Details
Thioredoxin 2 (TXN2) Human Gene Knockout Kit (CRISPR)
KN401666 1 Kit

Thioredoxin 2 (TXN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Selenosulfuric Acid Dipotassium Salt, Technical Grade
TRC-S252500-50MG 50 mg

Selenosulfuric Acid Dipotassium Salt, Technical Grade

Sign In for Pricing
View Details