Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-2 (srg-2)

This Recombinant Serpentine receptor class gamma-2 (srg-2) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-2, Protein srg-2

UniProt

P46571

Expression Region

1-327

Origin

Caenorhabditis elegans

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDSSTAPLSIITKLALFERTCDSSYSPLAENLKYLVQFVYLLPAAMLHARILYILLWKHR NLYLKQSFYILFIMSCIACFTLVVQDIFFARVFQYMTQFCEPMSEFVENYPIFPAIYYPL QQHLHCAQPIIQILLTVNRMSCVVIPWKHSQVWKSFMKYAIALVILTPFLFIWNIIISKK LPVYTFGGFYIGYERVVIWATMTLFMLILRAITIVITAVCTFITVLRLTRMSKRLVSSER TLCIASFLISSCFLGTAAAESLFAFQVVRTSTSISYFLLPISWDILNVGTPIVMVMASSQ LRRHVFGILKRSRSNSRVEDGTIVTGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slco1a4 Mouse Gene Knockout Kit (CRISPR)
KN516221 1 Kit

Slco1a4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant RSV Fusion protein / RSV-F (Strain RSS-2) Protein (His Tag)
PKSV030232 100 µg

Recombinant RSV Fusion protein / RSV-F (Strain RSS-2) Protein (His Tag)

Sign In for Pricing
View Details
Recombinant DAP Kinase 1 Antibody
RC-15313-01 50 μL

Recombinant DAP Kinase 1 Antibody

Sign In for Pricing
View Details
Recombinant DAP Kinase 1 Antibody
RC-15313-02 100 µL

Recombinant DAP Kinase 1 Antibody

Sign In for Pricing
View Details
Recombinant DAP Kinase 1 Antibody
RC-15313-03 1 mL

Recombinant DAP Kinase 1 Antibody

Sign In for Pricing
View Details
Mouse Ubr1 activation kit by CRISPRa
GA204525 1 Kit

Mouse Ubr1 activation kit by CRISPRa

Sign In for Pricing
View Details