Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human RING finger protein 121 (RNF121)

This Recombinant Human RING finger protein 121 (RNF121) spans the amino acid sequence from region 1-327.

Product Specifications

Product Name Alternative

RING finger protein 121

UniProt

Q9H920

Expression Region

1-327

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAVVEVEVGGGAAGERELDEVDMSDLSPEEQWRVEHARMHAKHRGHEAMHAEMVLILIA TLVVAQLLLVQWKQRHPRSYNMVTLFQMWVVPLYFTVKLHWWRFLVIWILFSAVTAFVTF RATRKPLVQTTPRLVYKWFLLIYKISYATGIVGYMAVMFTLFGLNLLFKIKPEDAMDFGI SLLFYGLYYGVLERDFAEMCADYMASTIGFYSESGMPTKHLSDSVCAVCGQQIFVDVSEE GIIENTYRLSCNHVFHEFCIRGWCIVGKKQTCPYCKEKVDLKRMFSNPWERPHVMYGQLL DWLRYLVAWQPVIIGVVQGINYILGLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium Kluyveri serS Protein (aa 1-426) (strain ATCC 8527 / DSM 555 / NCIMB 10680)
VAng-Lsx9826-500gEcoli 500 µg (E. coli)

Recombinant Clostridium Kluyveri serS Protein (aa 1-426) (strain ATCC 8527 / DSM 555 / NCIMB 10680)

Sign In for Pricing
View Details
Recombinant Human PSG6 / PSG10 Protein (His tag)
MBS2545241-01 0.1 mg

Recombinant Human PSG6 / PSG10 Protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PSG6 / PSG10 Protein (His tag)
MBS2545241-02 5x 0.1 mg

Recombinant Human PSG6 / PSG10 Protein (His tag)

Sign In for Pricing
View Details
R3HCC1 Human siRNA Oligo Duplex (Locus ID 203069)
SR316422 1 Kit

R3HCC1 Human siRNA Oligo Duplex (Locus ID 203069)

Sign In for Pricing
View Details
TRIM68 CRISPR Activation Plasmid (h)
sc-407557-ACT 20 µg

TRIM68 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Kallikrein 8 Antibody
orb1320823 100 µL

Kallikrein 8 Antibody

Sign In for Pricing
View Details