Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppB2

UniProt

Q2FH55

Expression Region

1-328

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIIKSMLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKL GLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIP LGIIAAKRFHKWTDKVIRVISTLSISLPAFFIGIILLFIVTNLMNIDSVILSQFILPVIT LSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTILPIIPLLGISL GSLIGGTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLL DPKQRLQLGNPKIKTNTPLISESSDRHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC/XFD750 Anti-human CD22 Antibody *HIB22*
102201E2-AAT 500 Tests

APC/XFD750 Anti-human CD22 Antibody *HIB22*

Sign In for Pricing
View Details
Recombinant Maianthemum racemosum NAD (P)H-quinone oxidoreductase subunit 2, chloroplastic (ndhB), partial
MBS7085411 Inquire

Recombinant Maianthemum racemosum NAD (P)H-quinone oxidoreductase subunit 2, chloroplastic (ndhB), partial

Sign In for Pricing
View Details
HLA Class II Histocompatibility Antigen Gamma Chain (CD74) Antibody (ATTO 633)
abx441227 100 µg

HLA Class II Histocompatibility Antigen Gamma Chain (CD74) Antibody (ATTO 633)

Sign In for Pricing
View Details
Mouse Zfhx4 activation kit by CRISPRa
GA211152 1 Kit

Mouse Zfhx4 activation kit by CRISPRa

Sign In for Pricing
View Details
Syntaxin1A monoclonal Guinea pig recombinant IgG
110 318 50 µg

Syntaxin1A monoclonal Guinea pig recombinant IgG

Sign In for Pricing
View Details
Rabbit Polyclonal SLC39A7/ZIP7 Antibody [Alexa Fluor 405]
NBP3-30747AF405 0.1 mL

Rabbit Polyclonal SLC39A7/ZIP7 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details