Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppB2

UniProt

Q2FH55

Expression Region

1-328

Origin

Staphylococcus aureus (strain USA300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIIKSMLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKL GLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIP LGIIAAKRFHKWTDKVIRVISTLSISLPAFFIGIILLFIVTNLMNIDSVILSQFILPVIT LSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTILPIIPLLGISL GSLIGGTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLL DPKQRLQLGNPKIKTNTPLISESSDRHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Connexin 43 (CX43)
TRV-0007586-01 10 µg

Recombinant Connexin 43 (CX43)

Sign In for Pricing
View Details
Recombinant Connexin 43 (CX43)
TRV-0007586-02 50 µg

Recombinant Connexin 43 (CX43)

Sign In for Pricing
View Details
Recombinant Connexin 43 (CX43)
TRV-0007586-03 100 µg

Recombinant Connexin 43 (CX43)

Sign In for Pricing
View Details
Recombinant Connexin 43 (CX43)
TRV-0007586-04 200 µg

Recombinant Connexin 43 (CX43)

Sign In for Pricing
View Details
Recombinant Connexin 43 (CX43)
TRV-0007586-05 500 µg

Recombinant Connexin 43 (CX43)

Sign In for Pricing
View Details
Recombinant Connexin 43 (CX43)
TRV-0007586-06 1 mg

Recombinant Connexin 43 (CX43)

Sign In for Pricing
View Details