Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppB2

UniProt

Q6GH25

Expression Region

1-328

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIIKSILYRLIQMIVVLFVISTLAFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKL GLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIP LGIIAAKRFHKLSDKVIRVISTLSISLPAFFIGIILLFIVTNLMNIDSVILSQFILPVLT LSLGMCAYIIRLVRSNLLILLKSNIVQASRLRGMNERYILIHDLLKPTILPIIPLLGISL GSLIGGTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLL DPKQRLQLGNPKNKTNTPLISESSDRHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1312026 Protein Vector (Rat) (pPB-C-His)
PV300062 500 ng

RGD1312026 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
FMS Like Tyrosine Kinase 3 (Flt3) Human ELISA Kit
D4654 96 Tests

FMS Like Tyrosine Kinase 3 (Flt3) Human ELISA Kit

Sign In for Pricing
View Details
Glycopyrronium tosylate
T68082-01 1 mg

Glycopyrronium tosylate

Sign In for Pricing
View Details
Glycopyrronium tosylate
T68082-02 5 mg

Glycopyrronium tosylate

Sign In for Pricing
View Details
Glycopyrronium tosylate
T68082-03 10 mg

Glycopyrronium tosylate

Sign In for Pricing
View Details
Glycopyrronium tosylate
T68082-04 25 mg

Glycopyrronium tosylate

Sign In for Pricing
View Details