Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppB2

UniProt

Q6GH25

Expression Region

1-328

Origin

Staphylococcus aureus (strain MRSA252)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIIKSILYRLIQMIVVLFVISTLAFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKL GLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIP LGIIAAKRFHKLSDKVIRVISTLSISLPAFFIGIILLFIVTNLMNIDSVILSQFILPVLT LSLGMCAYIIRLVRSNLLILLKSNIVQASRLRGMNERYILIHDLLKPTILPIIPLLGISL GSLIGGTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLL DPKQRLQLGNPKNKTNTPLISESSDRHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBTD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
28189111 3x 1.0 µg

MBTD1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Chitotriose trihydrochloride
GC1115-25mg 25 mg

Chitotriose trihydrochloride

Sign In for Pricing
View Details
Melamine test strips
PRS0009 96 Tests

Melamine test strips

Sign In for Pricing
View Details
NDUFA9 (NM_005002) Human Tagged Lenti ORF Clone
RC203464L2 10 µg

NDUFA9 (NM_005002) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Leprel1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3626808 1.0 µg DNA

Leprel1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
GTPBP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0918905 3x 1.0 µg

GTPBP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details