Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppB2

UniProt

Q7A5Q6

Expression Region

1-328

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIIKSMLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKL GLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIP LGIIAAKRFHKWTDKVIRVISTLSISLPAFFIGIILLFIVTNLMNIDSVILSQFILPVIT LSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTILPIIPLLGISL GSLIGGTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLL DPKQRLQLGNPKNKTNTPLISESSDRHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXK2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0797502 1.0 µg DNA

FOXK2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PCP2 (Purkinje Cell Protein 2 Homolog, PCP2) (MaxLight 750)
MBS6458074-01 0.1 mL

PCP2 (Purkinje Cell Protein 2 Homolog, PCP2) (MaxLight 750)

Sign In for Pricing
View Details
PCP2 (Purkinje Cell Protein 2 Homolog, PCP2) (MaxLight 750)
MBS6458074-02 5x 0.1 mL

PCP2 (Purkinje Cell Protein 2 Homolog, PCP2) (MaxLight 750)

Sign In for Pricing
View Details
VPS24 Recombinant Antibody, PE Conjugated
bsm-62190R-PE 100 µL

VPS24 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Mmu-miR-6931-3p miRNA Mimic
CMM1330-01 5 nmol

Mmu-miR-6931-3p miRNA Mimic

Sign In for Pricing
View Details
Mmu-miR-6931-3p miRNA Mimic
CMM1330-02 10 nmol

Mmu-miR-6931-3p miRNA Mimic

Sign In for Pricing
View Details