Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 82 (Gpr82)

This Recombinant Mouse Probable G-protein coupled receptor 82 (Gpr82) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 82

UniProt

Q8BZR0

Expression Region

1-328

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNNSTCIQPSVISTTALPVTYIFLFIIGLFGNSLAQWVFLTKIGKKTSTHIYLANLVTA NLLVCTAMPFMGIYFLRGFYWKYQSVQCRLVNFLGTLSMHVSMFVSLLILSWIAISRYAT LMKKESKQEATSCYERMFYGHVLKRFRQPNFARTMCIYIWGVVLVIIIPVTLYYSVVEAT EEGQSQCYNRQMELGARPSQIAGLIGTTFIGFSFLVVVTSYYSLVSHLRRVRTCTSITEK DLTYRSVKRHLLIIQVLLVVCFLPYSIFKPIFYVLHQREGDCQQLNYLIEAKNILTCLAS ARSSTDPIIFLLLDKTFKKTLYGLLTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFITM1 sgRNA CRISPR Lentivector set (Human)
K1018101 3x 1.0 µg

IFITM1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Menoxymycin B
orb3024903-01 10 mg

Menoxymycin B

Sign In for Pricing
View Details
Menoxymycin B
orb3024903-02 50 mg

Menoxymycin B

Sign In for Pricing
View Details
Stradb sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3616104 1.0 µg DNA

Stradb sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Anti-RASSF2 Antibody Picoband®, Cy3 Conjugate
A04384-1-Cy3 100 µg/Vial

Anti-RASSF2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Runx3 Rat siRNA Oligo Duplex (Locus ID 156726)
SR506041 1 Kit

Runx3 Rat siRNA Oligo Duplex (Locus ID 156726)

Sign In for Pricing
View Details