Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 82 (Gpr82)

This Recombinant Mouse Probable G-protein coupled receptor 82 (Gpr82) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 82

UniProt

Q8BZR0

Expression Region

1-328

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNNSTCIQPSVISTTALPVTYIFLFIIGLFGNSLAQWVFLTKIGKKTSTHIYLANLVTA NLLVCTAMPFMGIYFLRGFYWKYQSVQCRLVNFLGTLSMHVSMFVSLLILSWIAISRYAT LMKKESKQEATSCYERMFYGHVLKRFRQPNFARTMCIYIWGVVLVIIIPVTLYYSVVEAT EEGQSQCYNRQMELGARPSQIAGLIGTTFIGFSFLVVVTSYYSLVSHLRRVRTCTSITEK DLTYRSVKRHLLIIQVLLVVCFLPYSIFKPIFYVLHQREGDCQQLNYLIEAKNILTCLAS ARSSTDPIIFLLLDKTFKKTLYGLLTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant ASFV War-054 Protein (aa 1-327)
VAng-2478Lsx-1mg 1 mg

Recombinant ASFV War-054 Protein (aa 1-327)

Sign In for Pricing
View Details
DELE1 HDR Plasmid (h)
sc-411350-HDR 20 µg

DELE1 HDR Plasmid (h)

Sign In for Pricing
View Details
Q Sepharose Fast Flow 25ml
17051010 1 Each

Q Sepharose Fast Flow 25ml

Sign In for Pricing
View Details
MSANTD3 (MSANTD3-TMEFF1) (NM_001198812) Human Tagged Lenti ORF Clone
RC231245L4 10 µg

MSANTD3 (MSANTD3-TMEFF1) (NM_001198812) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LHX1 Antibody
orb1258722 100 µL

LHX1 Antibody

Sign In for Pricing
View Details
IL1β polyclonal antibody
BS90705 50ul

IL1β polyclonal antibody

Sign In for Pricing
View Details