Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 82 (Gpr82)

This Recombinant Mouse Probable G-protein coupled receptor 82 (Gpr82) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 82

UniProt

Q8BZR0

Expression Region

1-328

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNNSTCIQPSVISTTALPVTYIFLFIIGLFGNSLAQWVFLTKIGKKTSTHIYLANLVTA NLLVCTAMPFMGIYFLRGFYWKYQSVQCRLVNFLGTLSMHVSMFVSLLILSWIAISRYAT LMKKESKQEATSCYERMFYGHVLKRFRQPNFARTMCIYIWGVVLVIIIPVTLYYSVVEAT EEGQSQCYNRQMELGARPSQIAGLIGTTFIGFSFLVVVTSYYSLVSHLRRVRTCTSITEK DLTYRSVKRHLLIIQVLLVVCFLPYSIFKPIFYVLHQREGDCQQLNYLIEAKNILTCLAS ARSSTDPIIFLLLDKTFKKTLYGLLTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ERK1 (Thr197 + Thr202) Rabbit Polyclonal Antibody (BF680)
orb2431921 100 µL

Phospho-ERK1 (Thr197 + Thr202) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
KCNF1 AAV Vector (Human) (CMV)
25354101 1 µg

KCNF1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Eotaxin (CCL11) Human Over-expression Lysate
orb1358145 100 µg

Eotaxin (CCL11) Human Over-expression Lysate

Sign In for Pricing
View Details
CDK14 polyclonal antibody
BS78440-01 50 µL

CDK14 polyclonal antibody

Sign In for Pricing
View Details
CDK14 polyclonal antibody
BS78440-02 100 µL

CDK14 polyclonal antibody

Sign In for Pricing
View Details
KIF21B Antibody
orb422823-01 50 µg

KIF21B Antibody

Sign In for Pricing
View Details