Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 82 (Gpr82)

This Recombinant Mouse Probable G-protein coupled receptor 82 (Gpr82) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 82

UniProt

Q8BZR0

Expression Region

1-328

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNNSTCIQPSVISTTALPVTYIFLFIIGLFGNSLAQWVFLTKIGKKTSTHIYLANLVTA NLLVCTAMPFMGIYFLRGFYWKYQSVQCRLVNFLGTLSMHVSMFVSLLILSWIAISRYAT LMKKESKQEATSCYERMFYGHVLKRFRQPNFARTMCIYIWGVVLVIIIPVTLYYSVVEAT EEGQSQCYNRQMELGARPSQIAGLIGTTFIGFSFLVVVTSYYSLVSHLRRVRTCTSITEK DLTYRSVKRHLLIIQVLLVVCFLPYSIFKPIFYVLHQREGDCQQLNYLIEAKNILTCLAS ARSSTDPIIFLLLDKTFKKTLYGLLTKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf61 (NM_175895) Human Untagged Clone
SC307045 10 µg

C12orf61 (NM_175895) Human Untagged Clone

Sign In for Pricing
View Details
JHDM1a, CT (FBXL11) (KDM2A, CXXC8, FBL7, FBXL11, JHDM1A, KIAA1004, Lysine-specific demethylase 2A, CXXC-type zinc finger protein 8, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, JmjC domain-containing histone demethylation protein 1A, [Histone-H3]-lysine-36 demethylase 1A) (AP) discontinued
037190-AP 200 µL

JHDM1a, CT (FBXL11) (KDM2A, CXXC8, FBL7, FBXL11, JHDM1A, KIAA1004, Lysine-specific demethylase 2A, CXXC-type zinc finger protein 8, F-box and leucine-rich repeat protein 11, F-box protein FBL7, F-box protein Lilina, F-box/LRR-repeat protein 11, JmjC domain-containing histone demethylation protein 1A, [Histone-H3]-lysine-36 demethylase 1A) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Brucella abortus biovar 1 Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1475497-01 0.02 mg (E-Coli)

Recombinant Brucella abortus biovar 1 Imidazole glycerol phosphate synthase subunit HisH (hisH)

Sign In for Pricing
View Details
Recombinant Brucella abortus biovar 1 Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1475497-02 0.1 mg (E-Coli)

Recombinant Brucella abortus biovar 1 Imidazole glycerol phosphate synthase subunit HisH (hisH)

Sign In for Pricing
View Details
Recombinant Brucella abortus biovar 1 Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1475497-03 0.02 mg (Yeast)

Recombinant Brucella abortus biovar 1 Imidazole glycerol phosphate synthase subunit HisH (hisH)

Sign In for Pricing
View Details
Recombinant Brucella abortus biovar 1 Imidazole glycerol phosphate synthase subunit HisH (hisH)
MBS1475497-04 0.1 mg (Yeast)

Recombinant Brucella abortus biovar 1 Imidazole glycerol phosphate synthase subunit HisH (hisH)

Sign In for Pricing
View Details