Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppB2

UniProt

Q8NWT4

Expression Region

1-328

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIIKSMLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKL GLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIP LGIIAAKRFHKWTDKVIRVISTLSISLPAFFIGIILLFIVTNLMNIDSVILSQFILPVIT LSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTILPIIPLLGISL GSLIGGTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLL DPKQRLQLGNPKIKTNTPLISVSSDRHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Na-Boc-Nd-allyloxycarbonyl-L-ornithine
285667 5 g

Na-Boc-Nd-allyloxycarbonyl-L-ornithine

Sign In for Pricing
View Details
MT-CO3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV771375 1.0 µg DNA

MT-CO3 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Bio bin 6ltr Purple
SAF7446 40 / PCK

Bio bin 6ltr Purple

Sign In for Pricing
View Details
Recombinant Agrobacterium tumefaciens Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1197332-01 0.02 mg (E-Coli)

Recombinant Agrobacterium tumefaciens Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Agrobacterium tumefaciens Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1197332-02 0.02 mg (Yeast)

Recombinant Agrobacterium tumefaciens Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details
Recombinant Agrobacterium tumefaciens Imidazole glycerol phosphate synthase subunit HisF (hisF)
MBS1197332-03 0.1 mg (E-Coli)

Recombinant Agrobacterium tumefaciens Imidazole glycerol phosphate synthase subunit HisF (hisF)

Sign In for Pricing
View Details