Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2)

This Recombinant Staphylococcus aureus Putative oligopeptide transport system permease protein oppB2 (oppB2) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Putative oligopeptide transport system permease protein oppB2

UniProt

Q8NWT4

Expression Region

1-328

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIIKSMLYRLMQMIVVLFVISTLTFILMKLSPGNPVDKILHLDVAQVSTEQINATKDKL GLNDSLLVQWWHWMNHLLHFNLGKSFESKEPVTQILFNYAPITLLISFSTLVVSLCISIP LGIIAAKRFHKWTDKVIRVISTLSISLPAFFIGIILLFIVTNLMNIDSVILSQFILPVIT LSLGMCAYIIRLVRSNLLMLLQSNIVQASRLRGMNERYILIHDLLKPTILPIIPLLGISL GSLIGGTVVIENLFDIPGIGYLLMDSIKSRDYPVIQGCVLFIGFFVVIINTIADLLTLLL DPKQRLQLGNPKIKTNTPLISVSSDRHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (N-Acetylsulphamoyl) benzeneboronic acid
OR9556-01 250 mg

4- (N-Acetylsulphamoyl) benzeneboronic acid

Sign In for Pricing
View Details
4- (N-Acetylsulphamoyl) benzeneboronic acid
OR9556-02 1 g

4- (N-Acetylsulphamoyl) benzeneboronic acid

Sign In for Pricing
View Details
RBM10 (DXS8237E, GPATC9, GPATCH9, KIAA0122, RNA-binding Protein 10, G Patch Domain-containing Protein 9, RNA-binding Motif Protein 10, RNA-binding Protein S1-1, MGC1132, MGC997) (PE)
MBS6159864-01 0.1 mL

RBM10 (DXS8237E, GPATC9, GPATCH9, KIAA0122, RNA-binding Protein 10, G Patch Domain-containing Protein 9, RNA-binding Motif Protein 10, RNA-binding Protein S1-1, MGC1132, MGC997) (PE)

Sign In for Pricing
View Details
RBM10 (DXS8237E, GPATC9, GPATCH9, KIAA0122, RNA-binding Protein 10, G Patch Domain-containing Protein 9, RNA-binding Motif Protein 10, RNA-binding Protein S1-1, MGC1132, MGC997) (PE)
MBS6159864-02 5x 0.1 mL

RBM10 (DXS8237E, GPATC9, GPATCH9, KIAA0122, RNA-binding Protein 10, G Patch Domain-containing Protein 9, RNA-binding Motif Protein 10, RNA-binding Protein S1-1, MGC1132, MGC997) (PE)

Sign In for Pricing
View Details
HTR1A Protein Vector (Mouse) (pPB-N-His)
PV190271 500 ng

HTR1A Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
FCGR2A CRISPR All-in-one AAV vector set (with saCas9)(Rat)
20386156 3x 1.0 µg DNA

FCGR2A CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details