Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Turkey astrovirus 2 Non-structural polyprotein 1A (ORF1)

This Recombinant Turkey astrovirus 2 Non-structural polyprotein 1A (ORF1) spans the amino acid sequence from region 798-1125.

Product Specifications

Product Name Alternative

Non-structural polyprotein 1A, Cleaved into the following 4 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20'

UniProt

Q9ILI6

Expression Region

798-1125

Origin

Turkey astrovirus 2 (TAstV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKGKTKKTVRGRKHLVTKRALGKGHFMKMRMLTDEEYQNMIEKGFSAEEIREAVNALREQ AWLNYCIDNDVDDEGEEDWYDDMVETDRVNQEIDEAIERAMEDRGEFYQKKSRLTFVEQA MMHLIQVSKERSQTAKLEVQKENEAQLVKMFERCVTDENTPEGTTSIAALSTEDDVRLVE GKVIDFTKAKNIPVDGEIRREIIPGTKCTEISTGPENKKNILKKKDTHIAEGKVETKSSQ QPVDVKDDKPVALEQRKPRACKWCGSSQKHDYRECRFQREKRFCVYCAAMHSMFEGHIRP IECTSCKKSFSGIEKLEDHVVSGECQKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coenzyme Q9
TRC-C636500-1MG 1 mg

Coenzyme Q9

Sign In for Pricing
View Details
1',6'-Dichlorosucrose
TRC-D122230-50MG 50 mg

1',6'-Dichlorosucrose

Sign In for Pricing
View Details
Cx40 / GJA5 Recombinant Rabbit monoclonal Antibody
HA723249 100 µL

Cx40 / GJA5 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
SNAP25 Mouse Monoclonal Antibody [Clone ID: 4E11]
AM09034PU-S 50 µL

SNAP25 Mouse Monoclonal Antibody [Clone ID: 4E11]

Sign In for Pricing
View Details
CD79a (IGA/764), Biotin conjugate, 0.1mg/mL
BNCB0764-500 1x 500 µL

CD79a (IGA/764), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Stathmin 1 Recombinant Rabbit Monoclonal Antibody [SS0453]
ET1609-20 100 µL

Stathmin 1 Recombinant Rabbit Monoclonal Antibody [SS0453]

Sign In for Pricing
View Details