Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Turkey astrovirus 2 Non-structural polyprotein 1A (ORF1)

This Recombinant Turkey astrovirus 2 Non-structural polyprotein 1A (ORF1) spans the amino acid sequence from region 798-1125.

Product Specifications

Product Name Alternative

Non-structural polyprotein 1A, Cleaved into the following 4 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20'

UniProt

Q9ILI6

Expression Region

798-1125

Origin

Turkey astrovirus 2 (TAstV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKGKTKKTVRGRKHLVTKRALGKGHFMKMRMLTDEEYQNMIEKGFSAEEIREAVNALREQ AWLNYCIDNDVDDEGEEDWYDDMVETDRVNQEIDEAIERAMEDRGEFYQKKSRLTFVEQA MMHLIQVSKERSQTAKLEVQKENEAQLVKMFERCVTDENTPEGTTSIAALSTEDDVRLVE GKVIDFTKAKNIPVDGEIRREIIPGTKCTEISTGPENKKNILKKKDTHIAEGKVETKSSQ QPVDVKDDKPVALEQRKPRACKWCGSSQKHDYRECRFQREKRFCVYCAAMHSMFEGHIRP IECTSCKKSFSGIEKLEDHVVSGECQKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), Biotin conjugate, 0.1mg/mL
BNCB2332-500 1x 500 µL

Thrombomodulin / CD141 (Endothelial Cell Marker) (rTHBD/1591), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p-Salicylic Acid 4-Glucuronide Potassium Salt
TRC-S088140-5MG 5 mg

p-Salicylic Acid 4-Glucuronide Potassium Salt

Sign In for Pricing
View Details
Azlocillin Sodium Salt
TRC-A930000-500MG 500 mg

Azlocillin Sodium Salt

Sign In for Pricing
View Details
Embigin homolog (EMB) Rabbit Polyclonal Antibody
TA375875 100 µL

Embigin homolog (EMB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FAM174B (NM_207446) Human Over-expression Lysate
LC404039 20 µg

FAM174B (NM_207446) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS621867 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details