Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Turkey astrovirus 2 Non-structural polyprotein 1A (ORF1)

This Recombinant Turkey astrovirus 2 Non-structural polyprotein 1A (ORF1) spans the amino acid sequence from region 798-1125.

Product Specifications

Product Name Alternative

Non-structural polyprotein 1A, Cleaved into the following 4 chains:, 1. Protein p19, 2. Transmembrane protein 1A, 3. Serine protease p27, 4. p27, EC= 5. 3.4.21.-, 6. Protein p20'

UniProt

Q9ILI6

Expression Region

798-1125

Origin

Turkey astrovirus 2 (TAstV-2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AKGKTKKTVRGRKHLVTKRALGKGHFMKMRMLTDEEYQNMIEKGFSAEEIREAVNALREQ AWLNYCIDNDVDDEGEEDWYDDMVETDRVNQEIDEAIERAMEDRGEFYQKKSRLTFVEQA MMHLIQVSKERSQTAKLEVQKENEAQLVKMFERCVTDENTPEGTTSIAALSTEDDVRLVE GKVIDFTKAKNIPVDGEIRREIIPGTKCTEISTGPENKKNILKKKDTHIAEGKVETKSSQ QPVDVKDDKPVALEQRKPRACKWCGSSQKHDYRECRFQREKRFCVYCAAMHSMFEGHIRP IECTSCKKSFSGIEKLEDHVVSGECQKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC2 (NM_181471) Human Recombinant Protein
TP320036 20 µg

RFC2 (NM_181471) Human Recombinant Protein

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF647 conjugate, 0.1mg/mL
BNC471133-500 1x 500 µL

CD74 (CLIP/1133), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Asic1 Mouse Monoclonal Antibody [Clone ID: N271/44]
75-277 100 µL

Asic1 Mouse Monoclonal Antibody [Clone ID: N271/44]

Sign In for Pricing
View Details
MRPS16 (NM_016065) Human Recombinant Protein
TP305837M 100 µg

MRPS16 (NM_016065) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Mouse PTK6/Brk Protein (His & GST Tag)
PKSM040298 50 µg

Recombinant Mouse PTK6/Brk Protein (His & GST Tag)

Sign In for Pricing
View Details
gamma Adducin (ADD3) (NM_016824) Human Recombinant Protein
TP309129 20 µg

gamma Adducin (ADD3) (NM_016824) Human Recombinant Protein

Sign In for Pricing
View Details