Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dickeya dadantii Uncharacterized protein Dda3937_02003 (Dda3937_02003)

This Recombinant Dickeya dadantii Uncharacterized protein Dda3937_02003 (Dda3937_02003) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Uncharacterized protein Dda3937_02003, K1 ORF

UniProt

P45417

Expression Region

1-328

Origin

Dickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVKPNQPRPSTKQDPSSGASRQRFGYVTGWLHRIRSVPAIAHFIRAGDRFNDRMGNQFG AAITYFSFLSLIPILMVSFATAGFVLASNPDLLTGLINRIVNSISDPSLARTLKNTVNTA VRQRTTVGLTGLLIALYSGVNWIGNLREAIHAQSRDVWERQPHEEEKIYLRYLWDFLSLI GLLLALVITLFLTSVAGSAQATIVRALGLNGIDWLRPVMTLIALSISIFANYLLFLWILW VLPRHNPRRGPLLRGTLMAAIGFEALKFAMTVALPELATSPSGAAFGSVIGLMTFFYFFA RLTLFCAAWIATADPKTDINTQAPLPGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WFDC11 Lentiviral Activation Particles (h)
sc-415262-LAC 200 µL

WFDC11 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
TBX1 Antibody
A36244-50UG 50 µg

TBX1 Antibody

Sign In for Pricing
View Details
Cmah ORF Vector (Rat) (pORF)
ORF065166 1.0 µg DNA

Cmah ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
MED19/LCMR1 Rabbit Polyclonal Antibody (BF594)
orb2476694 100 µL

MED19/LCMR1 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
ACEI Antibody
250451 0.1 mg

ACEI Antibody

Sign In for Pricing
View Details
MRPS18A Adenovirus (Human)
30541051 1.0 mL

MRPS18A Adenovirus (Human)

Sign In for Pricing
View Details