Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dickeya dadantii Uncharacterized protein Dda3937_02003 (Dda3937_02003)

This Recombinant Dickeya dadantii Uncharacterized protein Dda3937_02003 (Dda3937_02003) spans the amino acid sequence from region 1-328.

Product Specifications

Product Name Alternative

Uncharacterized protein Dda3937_02003, K1 ORF

UniProt

P45417

Expression Region

1-328

Origin

Dickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937) )

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVKPNQPRPSTKQDPSSGASRQRFGYVTGWLHRIRSVPAIAHFIRAGDRFNDRMGNQFG AAITYFSFLSLIPILMVSFATAGFVLASNPDLLTGLINRIVNSISDPSLARTLKNTVNTA VRQRTTVGLTGLLIALYSGVNWIGNLREAIHAQSRDVWERQPHEEEKIYLRYLWDFLSLI GLLLALVITLFLTSVAGSAQATIVRALGLNGIDWLRPVMTLIALSISIFANYLLFLWILW VLPRHNPRRGPLLRGTLMAAIGFEALKFAMTVALPELATSPSGAAFGSVIGLMTFFYFFA RLTLFCAAWIATADPKTDINTQAPLPGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Ba71V-126 Recombinant Antibody (clone 2G6G10)
VS4-WK162 Each

Mouse Anti-Ba71V-126 Recombinant Antibody (clone 2G6G10)

Sign In for Pricing
View Details
PRSS37 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2796806 1.0 µg DNA

PRSS37 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
MYH7 Rabbit Polyclonal Antibody
orb1206-01 50 μL

MYH7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYH7 Rabbit Polyclonal Antibody
orb1206-02 100 µL

MYH7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYH7 Rabbit Polyclonal Antibody
orb1206-03 200 µL

MYH7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Pancreatic Polypeptide/PP ELISA Kit (Colorimetric)
NBP2-82418 1 Kit

Mouse Pancreatic Polypeptide/PP ELISA Kit (Colorimetric)

Sign In for Pricing
View Details