Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Probable polyprenol reductase (Srd5a3)

This Recombinant Rat Probable polyprenol reductase (Srd5a3) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Probable polyprenol reductase, EC= 1.3.1.-, 3-oxo-5-alpha-steroid 4-dehydrogenase 3, EC= 1.3.99.5, Steroid 5-alpha-reductase 3, S5AR 3, SR type 3

UniProt

Q5RJM1

Expression Region

1-330

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGWAGAELSVLNPLRALWLLLAAAFLLALLLQLAPARLLPSCALFQDLIRYGKTKQSGS RRPAVCRAFDVPKRYFSHFYVVSVLWNGSLLWFLSQSLFLGAPFPSWLWALLRTLGVTQF QALGMESKASRIQGKKLALSTFLVLVFLWVHSLRRLFECFYVSVFSNTAIHVVQYCFGLV YYVLVGLTVLSQVPMNDKNVYALGKNLLLQARWFHILGMMMFFWSSAHQYKCHVILSNLR RNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNVTWWLVVTYVFFSQ ALSAFFNHRFYKSTFVSYPKHRKAFLPFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LILRA2 (Center) Rabbit Polyclonal Antibody
AP52479PU-N 400 µL

LILRA2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dazukibart Biosimilar - Research Grade
ICH5220-5mg 5 mg

Dazukibart Biosimilar - Research Grade

Sign In for Pricing
View Details
Recombinant Human DC-SIGNR/CD299/CLEC4M Protein (Fc Tag)
PKSH031526 100 µg

Recombinant Human DC-SIGNR/CD299/CLEC4M Protein (Fc Tag)

Sign In for Pricing
View Details
Rps27 Mouse Gene Knockout Kit (CRISPR)
KN515096 1 Kit

Rps27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NF-kB p65 (RELA) Rabbit Polyclonal Antibody
AP06546PU-N 100 µg

NF-kB p65 (RELA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HRS (Ab-334) Antibody
8B1044-AAT 50 µg

HRS (Ab-334) Antibody

Sign In for Pricing
View Details