Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Probable polyprenol reductase (Srd5a3)

This Recombinant Rat Probable polyprenol reductase (Srd5a3) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Probable polyprenol reductase, EC= 1.3.1.-, 3-oxo-5-alpha-steroid 4-dehydrogenase 3, EC= 1.3.99.5, Steroid 5-alpha-reductase 3, S5AR 3, SR type 3

UniProt

Q5RJM1

Expression Region

1-330

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGWAGAELSVLNPLRALWLLLAAAFLLALLLQLAPARLLPSCALFQDLIRYGKTKQSGS RRPAVCRAFDVPKRYFSHFYVVSVLWNGSLLWFLSQSLFLGAPFPSWLWALLRTLGVTQF QALGMESKASRIQGKKLALSTFLVLVFLWVHSLRRLFECFYVSVFSNTAIHVVQYCFGLV YYVLVGLTVLSQVPMNDKNVYALGKNLLLQARWFHILGMMMFFWSSAHQYKCHVILSNLR RNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNVTWWLVVTYVFFSQ ALSAFFNHRFYKSTFVSYPKHRKAFLPFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP Antibody (phospho-S177)
F48726-0.08ML 0.08 mL

PARP Antibody (phospho-S177)

Sign In for Pricing
View Details
MAP3K12 binding inhibitory protein 1 (MBIP) (NM_001144891) Human Recombinant Protein
TP720564L 500 µg

MAP3K12 binding inhibitory protein 1 (MBIP) (NM_001144891) Human Recombinant Protein

Sign In for Pricing
View Details
Carbonic Anhydrase IX (CA9) Human Gene Knockout Kit (CRISPR)
KN204839LP 1 Kit

Carbonic Anhydrase IX (CA9) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Barium Carbonate
TRC-B127630-5G 5 g

Barium Carbonate

Sign In for Pricing
View Details
3-chloro-5-fluoro-4-hydroxybenzoic Acid
TRC-C375053-25MG 25 mg

3-chloro-5-fluoro-4-hydroxybenzoic Acid

Sign In for Pricing
View Details
UPF3A Rabbit Polyclonal Antibody
TA367839 100 µL

UPF3A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details