Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable polyprenol reductase (Srd5a3)

This Recombinant Mouse Probable polyprenol reductase (Srd5a3) spans the amino acid sequence from region 1-330.

Product Specifications

Product Name Alternative

Probable polyprenol reductase, EC= 1.3.1.-, 3-oxo-5-alpha-steroid 4-dehydrogenase 3, EC= 1.3.99.5, Steroid 5-alpha-reductase 2-like, Steroid 5-alpha-reductase 3, S5AR 3

UniProt

Q9WUP4

Expression Region

1-330

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGWAGFELSALNPLRTLWLALAAAFLFALLLQLAPARLLPSCALFQDLLRYGKTKQSGS RRPAVCRAFDVPKRYFSHFYVISVVWNGSLLWLLSQSLFLGAPFPNWLSALLRTLGATQF QALEMESKASRMPAAELALSAFLVLVFLWVHSLRRLFECFYVSVFSNAAIHVVQYCFGLV YYVLVGLTVLSQVPMDDKNVYVLGKNLLIQARWFHILGMVMFFWSSAHQYKCHVILSNLR RNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNLTWWLVVTYVFSSQ ALSAFFNHKFYRSTFVSYPKHRKAFLPFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tryptophan 5-hydroxylase 2 (TPH2) Goat Polyclonal Antibody
AP33143PU-N 100 µg

Tryptophan 5-hydroxylase 2 (TPH2) Goat Polyclonal Antibody

Sign In for Pricing
View Details
LNK (SH2B3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C9]
TA502933AM 100 µL

LNK (SH2B3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C9]

Sign In for Pricing
View Details
Heptadecanedioic Acid
TRC-H998558-10MG 10 mg

Heptadecanedioic Acid

Sign In for Pricing
View Details
APBB1IP Antibody (Biotin)
KB-2533-01 50 μL

APBB1IP Antibody (Biotin)

Sign In for Pricing
View Details
APBB1IP Antibody (Biotin)
KB-2533-02 100 µL

APBB1IP Antibody (Biotin)

Sign In for Pricing
View Details
APBB1IP Antibody (Biotin)
KB-2533-03 1 mL

APBB1IP Antibody (Biotin)

Sign In for Pricing
View Details