Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Mitoferrin-1 (slc25a37)

This Recombinant Danio rerio Mitoferrin-1 (slc25a37) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Mitoferrin-1, Mitochondrial iron transporter 1, Protein frascati, Solute carrier family 25 member 37

UniProt

Q287T7

Expression Region

1-332

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRTDAVLASLEMSEPVKNDEDYESLPAHASLGTHMTAGAVAGILEHTVMYPVDSVKTR MQSLQPDPKAQYRSVYGALKRIVRTEGLLRPLRGLNITVLGAGPAHALYFACYERIKRSL SDVIQNGGNSHIANGVAGSVATVLHDAVMNPAEVVKQRMQMYNSPYRSLYDCVLMVSRKE GLAAFYRSYSTQLTMNIPFQAVHFITYEFMQEHFNPHRQYRPETHIISGAAAGAVSAAVT TPLDVCKTLLNTQENVALSSAHVSGHLSGMVNALRTVYRLGGVPAFFKGIQARVIYQMPS TAIAWSVYEFFKYFLTQHESHVQEVSHKTSPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RMXL1 Rabbit Polyclonal Antibody
BT-AP12306-01 20 µL

RMXL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RMXL1 Rabbit Polyclonal Antibody
BT-AP12306-02 50 µL

RMXL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RMXL1 Rabbit Polyclonal Antibody
BT-AP12306-03 100 µL

RMXL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti-GAL antibody
STJ23742 100 µl

Anti-GAL antibody

Sign In for Pricing
View Details
LOC91664 antibody
MBS5302691-01 0.1 mL

LOC91664 antibody

Sign In for Pricing
View Details
LOC91664 antibody
MBS5302691-02 5x 0.1 mL

LOC91664 antibody

Sign In for Pricing
View Details