Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Mitoferrin-1 (slc25a37)

This Recombinant Danio rerio Mitoferrin-1 (slc25a37) spans the amino acid sequence from region 1-332.

Product Specifications

Product Name Alternative

Mitoferrin-1, Mitochondrial iron transporter 1, Protein frascati, Solute carrier family 25 member 37

UniProt

Q287T7

Expression Region

1-332

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRTDAVLASLEMSEPVKNDEDYESLPAHASLGTHMTAGAVAGILEHTVMYPVDSVKTR MQSLQPDPKAQYRSVYGALKRIVRTEGLLRPLRGLNITVLGAGPAHALYFACYERIKRSL SDVIQNGGNSHIANGVAGSVATVLHDAVMNPAEVVKQRMQMYNSPYRSLYDCVLMVSRKE GLAAFYRSYSTQLTMNIPFQAVHFITYEFMQEHFNPHRQYRPETHIISGAAAGAVSAAVT TPLDVCKTLLNTQENVALSSAHVSGHLSGMVNALRTVYRLGGVPAFFKGIQARVIYQMPS TAIAWSVYEFFKYFLTQHESHVQEVSHKTSPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NADPH oxidase 4 Rabbit pAb, Pacific Blue conjugated
orb2850869 100 µL

NADPH oxidase 4 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
ITGBL1 (Integrin beta-like Protein 1, Osteoblast-specific Cysteine-rich Protein, Ten Integrin EGF-like Repeat Domain-containing Protein, OSCP, TIED) (Biotin)
138058-Biotin 100 µL

ITGBL1 (Integrin beta-like Protein 1, Osteoblast-specific Cysteine-rich Protein, Ten Integrin EGF-like Repeat Domain-containing Protein, OSCP, TIED) (Biotin)

Sign In for Pricing
View Details
Bovine Lymphotoxin-alpha, LTA ELISA KIT
E0064Bo-01 48 Well

Bovine Lymphotoxin-alpha, LTA ELISA KIT

Sign In for Pricing
View Details
Bovine Lymphotoxin-alpha, LTA ELISA KIT
E0064Bo-02 96 Well

Bovine Lymphotoxin-alpha, LTA ELISA KIT

Sign In for Pricing
View Details
Bovine Lymphotoxin-alpha, LTA ELISA KIT
E0064Bo-03 5x 96 Tests

Bovine Lymphotoxin-alpha, LTA ELISA KIT

Sign In for Pricing
View Details
Bovine Lymphotoxin-alpha, LTA ELISA KIT
E0064Bo-04 10x 96 Tests

Bovine Lymphotoxin-alpha, LTA ELISA KIT

Sign In for Pricing
View Details