Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Lipid phosphate phosphatase-related protein type 1 (lppr1)

This Recombinant Danio rerio Lipid phosphate phosphatase-related protein type 1 (lppr1) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase-related protein type 1

UniProt

Q6IQH6

Expression Region

1-333

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASDNTHRSYSIIPCFIFVELVIMAGTVLLAYYFECTDTFGIHIQGFFCNDADLLKPYPG PEESSFIQPLILYCVVAAAPTAIIFVGEISMYIMKSTGEALLAQEKTIVTGECCYLNPLI RRIIRFIGVFAFGLFATDIFVNAGQVVTGNLAPYFLNVCKPNYTGLDCHFSHQFIANGNI CTGNQVVVERARRSFPSKDASLSVYSAVYVTMYITSTIKTKSSRLAKPVLCLGLLCAAFL TGLNRVSEYRNHCSDVVAGFILGSSIALFLGICVVNNFKGTHSTPTKQKQEDYRGLPLMT FPRVESPLETLSAQGKSCQATLLTSSQPNTWSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL
BNC940391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL
BNC880385-100 1x 100 µL

CD3e (Rabbit PAb), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details