Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus pseudofirmus Dipeptide transport system permease protein dppB (dppB)

This Recombinant Bacillus pseudofirmus Dipeptide transport system permease protein dppB (dppB) spans the amino acid sequence from region 1-333.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppB

UniProt

P94311

Expression Region

1-333

Origin

Bacillus pseudofirmus (strain OF4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLAYAMRRLLLLIPVLIGMTIVTFSIIHLIPGNPAQTILGEQASPQAIADLEERLGLNEP YWVQYGLYMKDLATGDLGTSLRTNKPIMEEIWPYLAATIELTIFAMIFAIIIGVNAGIVS AWKQNSWFDYLSMFIALVGVSMPIFWLALMEQWIFAQELGWLPAFGRDNPRDPIISTTGL YVFDTIISGQFDKTWESIKHLILPGIALGTIPMAIIARMTRSSMLEVLRSDYIRTVNAKG SGQGVVIYKHALKNALIPVLTVVGLQTGNLLGGAILTETIFSWPGIGRYIFEAINYRDYP VIQSGILVVATIFVLINLFVDLLYSYIDPRIKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCSK9 Rabbit Polyclonal Antibody
E10G22938 100 µL

PCSK9 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lasiocarpine N-oxide
MBS5775358 Inquire

Lasiocarpine N-oxide

Sign In for Pricing
View Details
ANKMY2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]
TA507314 100 µL

ANKMY2 Mouse Monoclonal Antibody [Clone ID: OTI1C12]

Sign In for Pricing
View Details
CDK18 Antibody
orb1278876 100 µL

CDK18 Antibody

Sign In for Pricing
View Details
Recombinant Human FHL2 Protein
NBP2-51868-0.1mg 0.1 mg

Recombinant Human FHL2 Protein

Sign In for Pricing
View Details
Lentiviral human PTPRN shRNA (UAS) - Lentiviral human PTPRN shRNA (UAS, GFP) plasmid
GTR15344473 1 Vial

Lentiviral human PTPRN shRNA (UAS) - Lentiviral human PTPRN shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details