Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gemmatimonas aurantiaca Protein translocase subunit SecF (secF)

This Recombinant Gemmatimonas aurantiaca Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

C1A8P3

Expression Region

1-334

Origin

Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRIFHNTKYEFVRWWRVAAGLTLAFIAAGFVSFAVTGGVNYSIEFTGGTLMQLQFKTPP DVAEVRSALDAAGIQGAEIQQFGANTDFTIRARDEKQVEAQDAGAEGISRQITAALDAKF GAGTVTIVRTEAVGPKVGAELRTGAAMAMLIASIFTLIYLAIRFDWRFGLAAVLSTTHDI LITLAFIKIFHIEVSLTVVAAILTLVGYSANDTIIIFDRVRENLKKPHKGETLSHILDRS INETLPRSIMTHTTTFSATLALLLLAGEVIRPFAWVMAFGVVMATFSSIYVAGPLLLWIE GRWPRLDDAATARAVRAGEAATTTARGTDRVSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human H4-16 activation kit by CRISPRa
GA114751 1 Kit

Human H4-16 activation kit by CRISPRa

Sign In for Pricing
View Details
Human C9orf40 activation kit by CRISPRa
GA110493 1 Kit

Human C9orf40 activation kit by CRISPRa

Sign In for Pricing
View Details
RPAB1 Antibody
8C15486-AAT 50 µg

RPAB1 Antibody

Sign In for Pricing
View Details
Recombinant PDHA1 Antibody
RC-6397-01 50 μL

Recombinant PDHA1 Antibody

Sign In for Pricing
View Details
Recombinant PDHA1 Antibody
RC-6397-02 100 µL

Recombinant PDHA1 Antibody

Sign In for Pricing
View Details
Recombinant PDHA1 Antibody
RC-6397-03 1 mL

Recombinant PDHA1 Antibody

Sign In for Pricing
View Details