Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gemmatimonas aurantiaca Protein translocase subunit SecF (secF)

This Recombinant Gemmatimonas aurantiaca Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

C1A8P3

Expression Region

1-334

Origin

Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRIFHNTKYEFVRWWRVAAGLTLAFIAAGFVSFAVTGGVNYSIEFTGGTLMQLQFKTPP DVAEVRSALDAAGIQGAEIQQFGANTDFTIRARDEKQVEAQDAGAEGISRQITAALDAKF GAGTVTIVRTEAVGPKVGAELRTGAAMAMLIASIFTLIYLAIRFDWRFGLAAVLSTTHDI LITLAFIKIFHIEVSLTVVAAILTLVGYSANDTIIIFDRVRENLKKPHKGETLSHILDRS INETLPRSIMTHTTTFSATLALLLLAGEVIRPFAWVMAFGVVMATFSSIYVAGPLLLWIE GRWPRLDDAATARAVRAGEAATTTARGTDRVSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF405S conjugate, 0.1mg/mL
BNC040892-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM110A (NM_001289147) Human Tagged ORF Clone
RG237256 10 µg

FAM110A (NM_001289147) Human Tagged ORF Clone

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), Biotin conjugate, 0.1mg/mL
BNCB1820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Rat REG4 Protein (His Tag)
PDER100156-01 20 µg

Recombinant Rat REG4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat REG4 Protein (His Tag)
PDER100156-02 100 µg

Recombinant Rat REG4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Rat REG4 Protein (His Tag)
PDER100156-03 500 µg

Recombinant Rat REG4 Protein (His Tag)

Sign In for Pricing
View Details