Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gemmatimonas aurantiaca Protein translocase subunit SecF (secF)

This Recombinant Gemmatimonas aurantiaca Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-334.

Product Specifications

Product Name Alternative

Protein translocase subunit SecF

UniProt

C1A8P3

Expression Region

1-334

Origin

Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRIFHNTKYEFVRWWRVAAGLTLAFIAAGFVSFAVTGGVNYSIEFTGGTLMQLQFKTPP DVAEVRSALDAAGIQGAEIQQFGANTDFTIRARDEKQVEAQDAGAEGISRQITAALDAKF GAGTVTIVRTEAVGPKVGAELRTGAAMAMLIASIFTLIYLAIRFDWRFGLAAVLSTTHDI LITLAFIKIFHIEVSLTVVAAILTLVGYSANDTIIIFDRVRENLKKPHKGETLSHILDRS INETLPRSIMTHTTTFSATLALLLLAGEVIRPFAWVMAFGVVMATFSSIYVAGPLLLWIE GRWPRLDDAATARAVRAGEAATTTARGTDRVSAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAM1 (NM_032152) Human Recombinant Protein
TP306972M 100 µg

PRAM1 (NM_032152) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS701649 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Frozen Tissue Sections, Endometrium
CS637630 5x 5 µm

Frozen Tissue Sections, Endometrium

Sign In for Pricing
View Details
Sdhaf2 Rabbit Polyclonal Antibody
TA363278 100 µL

Sdhaf2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD19 (CVID3/155), CF555 conjugate, 0.1mg/mL
BNC550155-100 1x 100 µL

CD19 (CVID3/155), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AKT1 (NM_001014431) Human Over-expression Lysate
LC423056 20 µg

AKT1 (NM_001014431) Human Over-expression Lysate

Sign In for Pricing
View Details