Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Myxococcus xanthus Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

This Recombinant Myxococcus xanthus Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

O30387

Expression Region

1-335

Origin

Myxococcus xanthus (strain DK 1622)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTHSSLPGYFGPLFAVFLFVLGLCVGSFLNVVIARVPLDQSIVRPRSRCPRCGHVLAWYE NIPLLSWLALRARCRGCGVPISVRYPLVELLTGLLFFACLRRFGWTYELVPALVLVSLLV PLAFIDLDHWILPLSMTVPGMLAGIALAFPLGMDAFRDALMGAAVGFLSFRMMEYVGWKV FQREALGAGDKYLVAMLGAFLTWRALLGVLLFASMQGAVVGILMLLATGRAGPRTENTQD EPAGDAPPLTMTWEFTQPGLPLWKRLLLVPVCLLVQPIPDAPLDEEGEEEEWVPERTSIP FGPWLALAGLELLLLGPWLSRVLPADIAMMLGGLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPF2 Antibody
KC-32088-01 50 μL

DPF2 Antibody

Sign In for Pricing
View Details
DPF2 Antibody
KC-32088-02 100 µL

DPF2 Antibody

Sign In for Pricing
View Details
DPF2 Antibody
KC-32088-03 1 mL

DPF2 Antibody

Sign In for Pricing
View Details
Mouse Vps50 activation kit by CRISPRa
GA209446 1 Kit

Mouse Vps50 activation kit by CRISPRa

Sign In for Pricing
View Details
TTF2 Human Gene Knockout Kit (CRISPR)
KN420957 1 Kit

TTF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody
AP14366PU-N 400 µL

Integrin Linked Kinase (ILK) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details