Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 9K2 (OR9K2)

This Recombinant Human Olfactory receptor 9K2 (OR9K2) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Olfactory receptor 9K2, Olfactory receptor OR12-2

UniProt

Q8NGE7

Expression Region

1-335

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGSKPRVHLYILPCASQQVSTMGDRGTSNHSEMTDFILAGFRVRPELHILLFLLFLFVY AMILLGNVGMMTIIMTDPRLNTPMYFFLGNLSFIDLFYSSVIEPKAMINFWSENKSISFA GCVAQLFLFALLIVTEGFLLAAMAYDRFIAICNPLLYSVQMSTRLCTQLVAGSYFCGCIS SVIQTSMTFTLSFCASRAVDHFYCDSRPLQRLSCSDLFIHRMISFSLSCIIILPTIIVII VSYMYIVSTVLKIHSTEGHKKAFSTCSSHLGVVSVLYGAVFFMYLTPDRFPELSKVASLC YSLVTPMLNPLIYSLRNKDVQEALKKFLEKKNIIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KNG1 Antibody - N-terminal region (ARP59203_P050)
ARP59203_P050 100 µL

KNG1 Antibody - N-terminal region (ARP59203_P050)

Sign In for Pricing
View Details
Anti-GAD65
A3091-1mg*5 5x 1mg

Anti-GAD65

Sign In for Pricing
View Details
Rabbit Polyclonal MERS-CoV Nucleoprotein Antibody
NBP3-13422 100 µL

Rabbit Polyclonal MERS-CoV Nucleoprotein Antibody

Sign In for Pricing
View Details
Sheep Glutathione S Transferase Alpha 3 ELISA Kit
MBS7275404-01 48 Well

Sheep Glutathione S Transferase Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Glutathione S Transferase Alpha 3 ELISA Kit
MBS7275404-02 96 Well

Sheep Glutathione S Transferase Alpha 3 ELISA Kit

Sign In for Pricing
View Details
Sheep Glutathione S Transferase Alpha 3 ELISA Kit
MBS7275404-03 5x 96 Well

Sheep Glutathione S Transferase Alpha 3 ELISA Kit

Sign In for Pricing
View Details