Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 9K2 (OR9K2)

This Recombinant Human Olfactory receptor 9K2 (OR9K2) spans the amino acid sequence from region 1-335.

Product Specifications

Product Name Alternative

Olfactory receptor 9K2, Olfactory receptor OR12-2

UniProt

Q8NGE7

Expression Region

1-335

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGSKPRVHLYILPCASQQVSTMGDRGTSNHSEMTDFILAGFRVRPELHILLFLLFLFVY AMILLGNVGMMTIIMTDPRLNTPMYFFLGNLSFIDLFYSSVIEPKAMINFWSENKSISFA GCVAQLFLFALLIVTEGFLLAAMAYDRFIAICNPLLYSVQMSTRLCTQLVAGSYFCGCIS SVIQTSMTFTLSFCASRAVDHFYCDSRPLQRLSCSDLFIHRMISFSLSCIIILPTIIVII VSYMYIVSTVLKIHSTEGHKKAFSTCSSHLGVVSVLYGAVFFMYLTPDRFPELSKVASLC YSLVTPMLNPLIYSLRNKDVQEALKKFLEKKNIIL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prickle3 (NM_175097) Mouse Tagged ORF Clone Lentiviral Particle
MR209523L3V 200 µL

Prickle3 (NM_175097) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AHR antagonist 1 10mM * 1mL in DMSO
A19881-10mM-D 10 mM x 1mL in DMSO

AHR antagonist 1 10mM * 1mL in DMSO

Sign In for Pricing
View Details
Receptor-binding cancer antigen expressed on SiSo cells (RCAS1) Human ELISA Kit
G6861 96 Tests

Receptor-binding cancer antigen expressed on SiSo cells (RCAS1) Human ELISA Kit

Sign In for Pricing
View Details
Human Siglec-9 Alexa Fluor 405 Antibody (Clone 191240)
FAB1139V-100UG 100 µg

Human Siglec-9 Alexa Fluor 405 Antibody (Clone 191240)

Sign In for Pricing
View Details
TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit C (TAF1C) Antibody
abx321634-01 20 µL

TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit C (TAF1C) Antibody

Sign In for Pricing
View Details
TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit C (TAF1C) Antibody
abx321634-02 50 µL

TATA-Box Binding Protein Associated Factor, RNA Polymerase I Subunit C (TAF1C) Antibody

Sign In for Pricing
View Details