Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Transmembrane protein 19 (TMEM19)

This Recombinant Pongo abelii Transmembrane protein 19 (TMEM19) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q5RF73

Expression Region

1-336

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLNDNICKRYIKMITNIVILSLIICISLAFWIMSMTASTYYGNLRPISPWRWLFSVVV PVLIISNGLKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFLSSSKLTKWKGEMKKR LDSEYKEGGQRNWIQVFCNGAVPTELALLYMIENGPGEIPVDFSKQYSASWMCLSLLAAL ACSAGDTWASEVGPVLSKSPPRLITTWEKVPVGTNGGVTVVGLVSSLLGGTFVGIAYFLT QLIFVNDLDISAPQWPIIAFGGLAGLLGSIVDSYLGATMQYTGLDESTGMVVNSPTNEAK HIAGKPILDNNAVNLFSSVLIAVLLPTAAWGFWPRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM9 (NM_001288569) Human Tagged ORF Clone
RG236359 10 µg

TMEM9 (NM_001288569) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Lymphoid tissue
CS804925 5x 5 µm

Tissue FFPE Sections, Lymphoid tissue

Sign In for Pricing
View Details
Human TMEM154 activation kit by CRISPRa
GA116407 1 Kit

Human TMEM154 activation kit by CRISPRa

Sign In for Pricing
View Details
Optitrol Green
SR11043 2x 5 mL

Optitrol Green

Sign In for Pricing
View Details
OR5A1 Antibody
8G909-AAT 50 µg

OR5A1 Antibody

Sign In for Pricing
View Details
MSMB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12F2]
TA803513AM 100 µL

MSMB Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI12F2]

Sign In for Pricing
View Details