Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Transmembrane protein 19 (TMEM19)

This Recombinant Pongo abelii Transmembrane protein 19 (TMEM19) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q5RF73

Expression Region

1-336

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDLNDNICKRYIKMITNIVILSLIICISLAFWIMSMTASTYYGNLRPISPWRWLFSVVV PVLIISNGLKKKSLDHSGALGGLVVGFILTIANFSFFTSLLMFFLSSSKLTKWKGEMKKR LDSEYKEGGQRNWIQVFCNGAVPTELALLYMIENGPGEIPVDFSKQYSASWMCLSLLAAL ACSAGDTWASEVGPVLSKSPPRLITTWEKVPVGTNGGVTVVGLVSSLLGGTFVGIAYFLT QLIFVNDLDISAPQWPIIAFGGLAGLLGSIVDSYLGATMQYTGLDESTGMVVNSPTNEAK HIAGKPILDNNAVNLFSSVLIAVLLPTAAWGFWPRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-17F, Tag Free
HA211035-01 Inquire

Mouse IL-17F, Tag Free

Sign In for Pricing
View Details
Mouse IL-17F, Tag Free
HA211035-02 50 µg

Mouse IL-17F, Tag Free

Sign In for Pricing
View Details
Mouse IL-17F, Tag Free
HA211035-03 100 µg

Mouse IL-17F, Tag Free

Sign In for Pricing
View Details
CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF594 conjugate, 0.1mg/mL
BNC941506-100 1x 100 µL

CD1a / HTA1 (Mature Langerhans Cells Marker) (C1A/1506R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DEFB127 Human Gene Knockout Kit (CRISPR)
KN422304 1 Kit

DEFB127 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TCF12 (NM_207036) Human Over-expression Lysate
LC403720 20 µg

TCF12 (NM_207036) Human Over-expression Lysate

Sign In for Pricing
View Details