Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Transmembrane protein 19 (tmem19)

This Recombinant Xenopus laevis Transmembrane protein 19 (tmem19) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q6IR76

Expression Region

1-336

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFIQDELYKEYVKMMMNIVILCMILSISLSFWMISITASTYSGTLRPISPWRWLVSLLT PIIIVSHGIKKRSLDSSGALGGLLVGFILTIANYSFFSALLAFFFISSKLTKWRGEVKKC YDSEYKEGGQRNWVQVFCNGGLPAELALLYMIENGPGEIPIDFSKEYTASWMCLSLLGAL SCSAGDTWASEIGPVLSKSAPRLITTWEKVPVGTNGGVTPIGLISSLLGGISVGVAYFVT QLVFVDDLEIAAPQWPIVIYGGMAGLLGSLIDSYLGAIMQYSGYDESTGKIVNHPTKDAK FICGKPILDNNAVNLFSSILIALLLPTAAWSFWPRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-100 1x 100 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2966), CF594 conjugate, 0.1mg/mL
BNC942966-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2966), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL
BNC680917-100 1x 100 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Antigen (PSA) (3E6), CF568 conjugate, 0.1mg/mL
BNC681777-500 1x 500 µL

Prostate Specific Antigen (PSA) (3E6), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details