Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 19 (Tmem19)

This Recombinant Mouse Transmembrane protein 19 (Tmem19) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q91W52

Expression Region

1-336

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDSDDTTCKRYIKMITNIVILSLIICISLAFWIMSMTASTYYGNFRPVSPWRWLFSVVV PVVIACNGFKKKSLDHSGALGGLVVGFILTIANFSFFTSLMTFFLSSSKLTKWRGNIKKQ LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEMPIDFSKQHTASWMCLSLLAAL ASSAGDTWASEVAPVLSKSSPRLITTWEKVPVGTNGGVTAVGLASSLLGGTFVGLAYFLT QLVFVNDLDISAPQWPIIAFGGVAGLFGSLVDSFLGATMQFSGLDERTGLVVSSPTQETK HIAGKPILDNNAVNLFSSVLVALLLPTAASGFWPRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1382 shRNA Plasmid (m)
sc-150529-SH 20 µg

Olfr1382 shRNA Plasmid (m)

Sign In for Pricing
View Details
CYP1A1, CT (Cytochrome P450 1A1, Cytochrome P450-P1, Cytochrome P450 Form 6, Cytochrome P450-C) (MaxLight 550)
MBS6471520-01 0.1 mL

CYP1A1, CT (Cytochrome P450 1A1, Cytochrome P450-P1, Cytochrome P450 Form 6, Cytochrome P450-C) (MaxLight 550)

Sign In for Pricing
View Details
CYP1A1, CT (Cytochrome P450 1A1, Cytochrome P450-P1, Cytochrome P450 Form 6, Cytochrome P450-C) (MaxLight 550)
MBS6471520-02 5x 0.1 mL

CYP1A1, CT (Cytochrome P450 1A1, Cytochrome P450-P1, Cytochrome P450 Form 6, Cytochrome P450-C) (MaxLight 550)

Sign In for Pricing
View Details
TLR2 Protein Vector (Rat) (pPB-C-His)
PV311022 500 ng

TLR2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
MyD88 Antibody Blocking Peptide
orb72999 500 µg

MyD88 Antibody Blocking Peptide

Sign In for Pricing
View Details
Rab 27a shRNA (m) Lentiviral Particles
sc-41835-V 200 µL

Rab 27a shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details