Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 19 (Tmem19)

This Recombinant Mouse Transmembrane protein 19 (Tmem19) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q91W52

Expression Region

1-336

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDSDDTTCKRYIKMITNIVILSLIICISLAFWIMSMTASTYYGNFRPVSPWRWLFSVVV PVVIACNGFKKKSLDHSGALGGLVVGFILTIANFSFFTSLMTFFLSSSKLTKWRGNIKKQ LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEMPIDFSKQHTASWMCLSLLAAL ASSAGDTWASEVAPVLSKSSPRLITTWEKVPVGTNGGVTAVGLASSLLGGTFVGLAYFLT QLVFVNDLDISAPQWPIIAFGGVAGLFGSLVDSFLGATMQFSGLDERTGLVVSSPTQETK HIAGKPILDNNAVNLFSSVLVALLLPTAASGFWPRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD25/IL-2R alpha Antibody (IL2RA/4375R) - Azide and BSA Free
NBP3-20703 100 µg

Rabbit Monoclonal CD25/IL-2R alpha Antibody (IL2RA/4375R) - Azide and BSA Free

Sign In for Pricing
View Details
Beta Tubulin Antibody
E45R33619G-1 100 µL

Beta Tubulin Antibody

Sign In for Pricing
View Details
Pmel (NM_021882) Mouse Tagged Lenti ORF Clone
MR209549L4 10 µg

Pmel (NM_021882) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
BTG4, CT (BTG4, PC3B, Protein BTG4, BTG family member 4, Protein PC3b) (MaxLight 650)
MBS6279228-01 0.1 mL

BTG4, CT (BTG4, PC3B, Protein BTG4, BTG family member 4, Protein PC3b) (MaxLight 650)

Sign In for Pricing
View Details
BTG4, CT (BTG4, PC3B, Protein BTG4, BTG family member 4, Protein PC3b) (MaxLight 650)
MBS6279228-02 5x 0.1 mL

BTG4, CT (BTG4, PC3B, Protein BTG4, BTG family member 4, Protein PC3b) (MaxLight 650)

Sign In for Pricing
View Details
SLC14A1 (Urea Transporter 1, Solute Carrier Family 14 Member 1, Urea Transporter, Erythrocyte, HUT11, JK, RACH1, UT1, UTE, FLJ33745, FLJ41687) (Not for Export EU)
133404 100 µL

SLC14A1 (Urea Transporter 1, Solute Carrier Family 14 Member 1, Urea Transporter, Erythrocyte, HUT11, JK, RACH1, UT1, UTE, FLJ33745, FLJ41687) (Not for Export EU)

Sign In for Pricing
View Details