Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 19 (Tmem19)

This Recombinant Mouse Transmembrane protein 19 (Tmem19) spans the amino acid sequence from region 1-336.

Product Specifications

Product Name Alternative

Transmembrane protein 19

UniProt

Q91W52

Expression Region

1-336

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDSDDTTCKRYIKMITNIVILSLIICISLAFWIMSMTASTYYGNFRPVSPWRWLFSVVV PVVIACNGFKKKSLDHSGALGGLVVGFILTIANFSFFTSLMTFFLSSSKLTKWRGNIKKQ LDSEYKEGGQRNWVQVFCNGAVPTELALLYMIENGPGEMPIDFSKQHTASWMCLSLLAAL ASSAGDTWASEVAPVLSKSSPRLITTWEKVPVGTNGGVTAVGLASSLLGGTFVGLAYFLT QLVFVNDLDISAPQWPIIAFGGVAGLFGSLVDSFLGATMQFSGLDERTGLVVSSPTQETK HIAGKPILDNNAVNLFSSVLVALLLPTAASGFWPRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHODH Knockout Cell Line-HCT 116
RK-0358 1x 10^6

DHODH Knockout Cell Line-HCT 116

Sign In for Pricing
View Details
LGR5 antibody (N-term) [APR33679G]
APR33679G-01 50 µL

LGR5 antibody (N-term) [APR33679G]

Sign In for Pricing
View Details
LGR5 antibody (N-term) [APR33679G]
APR33679G-02 100 µL

LGR5 antibody (N-term) [APR33679G]

Sign In for Pricing
View Details
LGR5 antibody (N-term) [APR33679G]
APR33679G-03 200 µL

LGR5 antibody (N-term) [APR33679G]

Sign In for Pricing
View Details
LGR5 antibody (N-term) [APR33679G]
APR33679G-04 400 µL

LGR5 antibody (N-term) [APR33679G]

Sign In for Pricing
View Details
POLD1 Recombinant Antibody, PerCP Conjugated
bsm-62042R-PerCP-TR 20 µL

POLD1 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details