Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-17 (sra-17)

This Recombinant Serpentine receptor class alpha-17 (sra-17) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-17, Protein sra-17

UniProt

O17842

Expression Region

1-337

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQTELLESLKCASEGMVKAMTSTTMKLNFVFIATVIFLSFYFAGLAIQALLRNNIFSNS TRHILIVCLLNSIVHQAVTLETRIHQVYRSFVYSSEPCRLLFHFTECEVELYFYYLTNYF STYAVFSLTFDRLVSHYKPKYYFSHQYYVSNSLLIIQLLLSLSTYYVGLYGVPLVGYAPI CYYTPRLAVNFSKINDFRTATMVFCIIVTIFIYYLSVKSEKQIHRTSYSPGERYIACENV ATSQSVCILIVLQFACIMLSSFGVNYIRARESLMSEENFNKIAPFFPGVTYASLCLPLVI YFKTKLTIRNRKLRIGVMTSMYGDVGDHMNRLKKSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGBL3 (NM_178563) Human Over-expression Lysate
LC430505 20 µg

AGBL3 (NM_178563) Human Over-expression Lysate

Sign In for Pricing
View Details
Snap25 pSer187 Rabbit Polyclonal Antibody
AP26444PU-N 100 µL

Snap25 pSer187 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SNX10 (NM_013322) Human Recombinant Protein
TP306019 20 µg

SNX10 (NM_013322) Human Recombinant Protein

Sign In for Pricing
View Details
YIF1B (NM_001145462) Human Over-expression Lysate
LY428905 100 µg

YIF1B (NM_001145462) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS809418 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
Calcineurin A / PPP3CA (CALNA/2353), CF488A conjugate, 0.1mg/mL
BNC882353-500 1x 500 µL

Calcineurin A / PPP3CA (CALNA/2353), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details