Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class alpha-17 (sra-17)

This Recombinant Serpentine receptor class alpha-17 (sra-17) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Serpentine receptor class alpha-17, Protein sra-17

UniProt

O17842

Expression Region

1-337

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNQTELLESLKCASEGMVKAMTSTTMKLNFVFIATVIFLSFYFAGLAIQALLRNNIFSNS TRHILIVCLLNSIVHQAVTLETRIHQVYRSFVYSSEPCRLLFHFTECEVELYFYYLTNYF STYAVFSLTFDRLVSHYKPKYYFSHQYYVSNSLLIIQLLLSLSTYYVGLYGVPLVGYAPI CYYTPRLAVNFSKINDFRTATMVFCIIVTIFIYYLSVKSEKQIHRTSYSPGERYIACENV ATSQSVCILIVLQFACIMLSSFGVNYIRARESLMSEENFNKIAPFFPGVTYASLCLPLVI YFKTKLTIRNRKLRIGVMTSMYGDVGDHMNRLKKSWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNL2 (GLRX3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F2]
TA811095AM 100 µL

TXNL2 (GLRX3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F2]

Sign In for Pricing
View Details
Tissue FFPE Sections, Pleura
CS708279 5x 5 µm

Tissue FFPE Sections, Pleura

Sign In for Pricing
View Details
MES Sodium Salt
TRC-M218775-5G 5 g

MES Sodium Salt

Sign In for Pricing
View Details
BAX Polyclonal Antibody
E-AB-40521-01 25 µL

BAX Polyclonal Antibody

Sign In for Pricing
View Details
BAX Polyclonal Antibody
E-AB-40521-02 100 µL

BAX Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF640R conjugate, 0.1mg/mL
BNC400979-100 1x 100 µL

Cytokeratin 8/18 (KRT8/803 + KRT18/835), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details