Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-18 (srd-18)

This Recombinant Serpentine receptor class delta-18 (srd-18) spans the amino acid sequence from region 1-337.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-18, Protein srd-18

UniProt

P92001

Expression Region

1-337

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIIFFEIWHWSWALLGCYLNLLLAYLAIFKSPKAIKSYATLIINYAATDFVECALDSFLQ TRLLAVPGEAELVYIFNGPCKYIGSISCKVGLSFFLHCLTHSVWSLLLSFGYRFYILHNP SLSRLVLLKLILVFYIPSLIQALTYWTIFASREEILPLARQWFPYYDLDAETGVLTGIID LTNFVAIYSIGHICLPFFPVYITIFILRQKIINQLHVKQHVMSPDTKAAHSQLLKALTIQ AFIPIFVGIAVTFYFLSQSGLVRSPILEYSIYAVAILAPALSPITYLYFVRPYRQNVKRF IANPFKILLNTNTGSSIGVFHSGGRPSNFATTLNTSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caveolin 2 Antibody
E38PA5497 100 µL

Caveolin 2 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal AG-3/AGR3 Antibody (AGR3.1) [DyLight 405]
NBP1-45004V 0.1 mL

Mouse Monoclonal AG-3/AGR3 Antibody (AGR3.1) [DyLight 405]

Sign In for Pricing
View Details
HOXC9 Human siRNA Oligo Duplex (Locus ID 3225)
SR302203 1 Kit

HOXC9 Human siRNA Oligo Duplex (Locus ID 3225)

Sign In for Pricing
View Details
Caspase-1 (Cleaved D210) Rabbit Polyclonal Antibody
E28G1893 100 µL

Caspase-1 (Cleaved D210) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GABRA2 Antibody, FITC conjugated
CSB-PA009141LC01HU-01 50 µg

GABRA2 Antibody, FITC conjugated

Sign In for Pricing
View Details
GABRA2 Antibody, FITC conjugated
CSB-PA009141LC01HU-02 100 µg

GABRA2 Antibody, FITC conjugated

Sign In for Pricing
View Details