Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitoferrin-1 (Slc25a37)

This Recombinant Rat Mitoferrin-1 (Slc25a37) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Mitoferrin-1, Mitochondrial iron transporter 1, Solute carrier family 25 member 37

UniProt

Q66H23

Expression Region

1-338

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRRGGVGSQAAGRRMDGDCRDGGCGSKDAGSEDYENLPTSASVSTHMTAGAMAGILEH SIMYPVDSVKTRMQSLNPDPKARYTSIYGALKRIMHTEGFWRPLRGLNVMMMGAGPAHAM YFACYENMKRTLNDVFSHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQS ALSCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPRRDYNPQSHIIS GGLAGALAAAATTPLDVCKTLLNTQENMALSLANVSGRLSGMANAFRTVYQLNGLAGYFK GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRTLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-κB p65 (Ab-536) Antibody
8B7171-AAT 50 µg

NF-κB p65 (Ab-536) Antibody

Sign In for Pricing
View Details
Epac1 (RAPGEF3) (NM_001098532) Human Over-expression Lysate
LC420629 20 µg

Epac1 (RAPGEF3) (NM_001098532) Human Over-expression Lysate

Sign In for Pricing
View Details
eIF3A Recombinant Rabbit Monoclonal Antibody [JE58-60]
HA721375 100 µL

eIF3A Recombinant Rabbit Monoclonal Antibody [JE58-60]

Sign In for Pricing
View Details
FDXR Polyclonal Antibody
E-AB-19061-01 20 µL

FDXR Polyclonal Antibody

Sign In for Pricing
View Details
FDXR Polyclonal Antibody
E-AB-19061-02 60 µL

FDXR Polyclonal Antibody

Sign In for Pricing
View Details
FDXR Polyclonal Antibody
E-AB-19061-03 120 µL

FDXR Polyclonal Antibody

Sign In for Pricing
View Details