Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitoferrin-1 (Slc25a37)

This Recombinant Rat Mitoferrin-1 (Slc25a37) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Mitoferrin-1, Mitochondrial iron transporter 1, Solute carrier family 25 member 37

UniProt

Q66H23

Expression Region

1-338

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRRGGVGSQAAGRRMDGDCRDGGCGSKDAGSEDYENLPTSASVSTHMTAGAMAGILEH SIMYPVDSVKTRMQSLNPDPKARYTSIYGALKRIMHTEGFWRPLRGLNVMMMGAGPAHAM YFACYENMKRTLNDVFSHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQS ALSCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPRRDYNPQSHIIS GGLAGALAAAATTPLDVCKTLLNTQENMALSLANVSGRLSGMANAFRTVYQLNGLAGYFK GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRTLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GLIPR1 Protein (His Tag)
PKSH033396-01 10 µg

Recombinant Human GLIPR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human GLIPR1 Protein (His Tag)
PKSH033396-02 50 µg

Recombinant Human GLIPR1 Protein (His Tag)

Sign In for Pricing
View Details
D2Wsu81e (BC078441) Mouse Tagged ORF Clone
MG201597 10 µg

D2Wsu81e (BC078441) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
LAG3 Antibody
KC-47734-01 50 μL

LAG3 Antibody

Sign In for Pricing
View Details
LAG3 Antibody
KC-47734-02 100 µL

LAG3 Antibody

Sign In for Pricing
View Details
LAG3 Antibody
KC-47734-03 1 mL

LAG3 Antibody

Sign In for Pricing
View Details