Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Mitoferrin-1 (Slc25a37)

This Recombinant Rat Mitoferrin-1 (Slc25a37) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Mitoferrin-1, Mitochondrial iron transporter 1, Solute carrier family 25 member 37

UniProt

Q66H23

Expression Region

1-338

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRRGGVGSQAAGRRMDGDCRDGGCGSKDAGSEDYENLPTSASVSTHMTAGAMAGILEH SIMYPVDSVKTRMQSLNPDPKARYTSIYGALKRIMHTEGFWRPLRGLNVMMMGAGPAHAM YFACYENMKRTLNDVFSHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHQS ALSCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPRRDYNPQSHIIS GGLAGALAAAATTPLDVCKTLLNTQENMALSLANVSGRLSGMANAFRTVYQLNGLAGYFK GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRTLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Histone H2AX (phospho S139) Antibody
RC-6379-01 50 μL

Recombinant Histone H2AX (phospho S139) Antibody

Sign In for Pricing
View Details
Recombinant Histone H2AX (phospho S139) Antibody
RC-6379-02 100 µL

Recombinant Histone H2AX (phospho S139) Antibody

Sign In for Pricing
View Details
Recombinant Histone H2AX (phospho S139) Antibody
RC-6379-03 1 mL

Recombinant Histone H2AX (phospho S139) Antibody

Sign In for Pricing
View Details
Human ZNF532 activation kit by CRISPRa
GA110603 1 Kit

Human ZNF532 activation kit by CRISPRa

Sign In for Pricing
View Details
SCHIP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]
TA504468AM 100 µL

SCHIP1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E7]

Sign In for Pricing
View Details
Human SLC26A7 activation kit by CRISPRa
GA114509 1 Kit

Human SLC26A7 activation kit by CRISPRa

Sign In for Pricing
View Details