BD-3, Mouse
BD-3 Protein, Mouse is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.
Product Specifications
Product Name Alternative
BD-3 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/bd-3-protein-mouse.html
Purity
95.0
Smiles
KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
Molecular Formula
27358 (Gene_ID) Q9WTL0 (K23-K63) (Accession)
Molecular Weight
Approximately 10.06 kDa
References & Citations
[1]Bals R, et al. Mouse beta-defensin 3 is an inducible antimicrobial peptide expressed in the epithelia of multiple organs. Infect Immun. 1999 Jul;67 (7) :3542-7.|[2]Burd RS, et al. Murine beta-defensin-3 is an inducible peptide with limited tissue expression and broad-spectrum antimicrobial activity. Shock. 2002 Nov;18 (5) :461-4.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2931666-01 20 µg
Recombinant Aegilops tauschii Chloroplast envelope membrane protein (cemA)
Sign In for Pricing
View Details orb2931666-02 100 µg
Recombinant Aegilops tauschii Chloroplast envelope membrane protein (cemA)
Sign In for Pricing
View Details 
031879-FITC 200 µL
ANKFY1, CT (ANKFY1, ANKHZN, KIAA1255, Ankyrin repeat and FYVE domain-containing protein 1, Ankyrin repeats hooked to a zinc finger motif) (FITC) discontinued
Sign In for Pricing
View Details 