Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BD-3, Mouse

BD-3 Protein, Mouse is an inducible antimicrobial peptide and exhibits broad-spectrum antimicrobial activity.

Product Specifications

Product Name Alternative

BD-3 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/bd-3-protein-mouse.html

Purity

95.0

Smiles

KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK

Molecular Formula

27358 (Gene_ID) Q9WTL0 (K23-K63) (Accession)

Molecular Weight

Approximately 10.06 kDa

References & Citations

[1]Bals R, et al. Mouse beta-defensin 3 is an inducible antimicrobial peptide expressed in the epithelia of multiple organs. Infect Immun. 1999 Jul;67 (7) :3542-7.|[2]Burd RS, et al. Murine beta-defensin-3 is an inducible peptide with limited tissue expression and broad-spectrum antimicrobial activity. Shock. 2002 Nov;18 (5) :461-4.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-558 miRNA Agomir
orb1921226-01 5 nmol

Hsa-miR-558 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-558 miRNA Agomir
orb1921226-02 10 nmol

Hsa-miR-558 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-558 miRNA Agomir
orb1921226-03 20 nmol

Hsa-miR-558 miRNA Agomir

Sign In for Pricing
View Details
TP53 Recombinant Monoclonal Antibody
CSB-RA214807A0HU-01 50 μL

TP53 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
TP53 Recombinant Monoclonal Antibody
CSB-RA214807A0HU-02 100 µL

TP53 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
RASGRF1 polyclonal antibody
orb649136-01 50 μL

RASGRF1 polyclonal antibody

Sign In for Pricing
View Details