Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Metalloreductase STEAP1 (STEAP1)

This Recombinant Pig Metalloreductase STEAP1 (STEAP1) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Metalloreductase STEAP1, EC= 1.16.1.-, Six transmembrane endothelial antigen of PAEC, Six-transmembrane epithelial antigen of prostate 1

UniProt

Q9GL50

Expression Region

1-338

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESRQDITNQEELWKMKPRKNLEDDYLNEDSRENSMPKRPMLVHLHQTAHFDEFDCPPEL QHKQELFPKWHLPIKIAAIVSSLTFLYTLLREVIHPFVTSHQQYFYKIPILVINKVLPMV SITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDRWMVTRKQFGLLSFFFAVLHAVYSLS YPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVTLAILALLAVTSIPSV SDSLTWREFHYIQSTLGIVSLLLGTIHALIFAWNKWVDIKQFIWYTPPTFMIAVFLPTVV LICKVILLLPCLRRKILKIRHGWEDVTKINKTEMSSQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5L1 Human Gene Knockout Kit (CRISPR)
KN424782 1 Kit

OR5L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant RIOK3 Antibody
RN-14717-01 50 μL

Recombinant RIOK3 Antibody

Sign In for Pricing
View Details
Recombinant RIOK3 Antibody
RN-14717-02 100 µL

Recombinant RIOK3 Antibody

Sign In for Pricing
View Details
Recombinant RIOK3 Antibody
RN-14717-03 1 mL

Recombinant RIOK3 Antibody

Sign In for Pricing
View Details
GSK3 beta (GSK3B) pTyr216 Rabbit Polyclonal Antibody
AP02535PU-N 100 µL

GSK3 beta (GSK3B) pTyr216 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD84 (NM_003874) Human Over-expression Lysate
LY401277 100 µg

CD84 (NM_003874) Human Over-expression Lysate

Sign In for Pricing
View Details