Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitoferrin-1 (SLC25A37)

This Recombinant Human Mitoferrin-1 (SLC25A37) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Mitoferrin-1, Mitochondrial iron transporter 1, Mitochondrial solute carrier protein, Solute carrier family 25 member 37

UniProt

Q9NYZ2

Expression Region

1-338

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEH SVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAM YFACYENMKRTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRS AISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPHRTYNPQSHIIS GGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFK GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K3 Antibody
A14596-100UG 100 µg

MAP3K3 Antibody

Sign In for Pricing
View Details
PIN4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV706372 1.0 µg DNA

PIN4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
OR52I2, CT (OR52I2, Olfactory receptor 52I2, Olfactory receptor OR11-12) (MaxLight 650)
MBS6329105-01 0.1 mL

OR52I2, CT (OR52I2, Olfactory receptor 52I2, Olfactory receptor OR11-12) (MaxLight 650)

Sign In for Pricing
View Details
OR52I2, CT (OR52I2, Olfactory receptor 52I2, Olfactory receptor OR11-12) (MaxLight 650)
MBS6329105-02 5x 0.1 mL

OR52I2, CT (OR52I2, Olfactory receptor 52I2, Olfactory receptor OR11-12) (MaxLight 650)

Sign In for Pricing
View Details
Rabbit Anti-Human Peroxin 14 Polyclonal Antibody
PA86566HU-01 50 µg

Rabbit Anti-Human Peroxin 14 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Peroxin 14 Polyclonal Antibody
PA86566HU-02 100 µg

Rabbit Anti-Human Peroxin 14 Polyclonal Antibody

Sign In for Pricing
View Details