Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitoferrin-1 (SLC25A37)

This Recombinant Human Mitoferrin-1 (SLC25A37) spans the amino acid sequence from region 1-338.

Product Specifications

Product Name Alternative

Mitoferrin-1, Mitochondrial iron transporter 1, Mitochondrial solute carrier protein, Solute carrier family 25 member 37

UniProt

Q9NYZ2

Expression Region

1-338

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRSGSVGSQAVARRMDGDSRDGGGGKDATGSEDYENLPTSASVSTHMTAGAMAGILEH SVMYPVDSVKTRMQSLSPDPKAQYTSIYGALKKIMRTEGFWRPLRGVNVMIMGAGPAHAM YFACYENMKRTLNDVFHHQGNSHLANGIAGSMATLLHDAVMNPAEVVKQRLQMYNSQHRS AISCIRTVWRTEGLGAFYRSYTTQLTMNIPFQSIHFITYEFLQEQVNPHRTYNPQSHIIS GGLAGALAAAATTPLDVCKTLLNTQENVALSLANISGRLSGMANAFRTVYQLNGLAGYFK GIQARVIYQMPSTAISWSVYEFFKYFLTKRQLENRAPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM166A Rabbit Polyclonal Antibody (AP)
orb964438 100 µL

FAM166A Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
LOC498222 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
27221156 3x 1.0 µg DNA

LOC498222 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Queuine tRNA-ribosyltransferase (tgt)
MBS1133065-01 0.02 mg (E-Coli)

Recombinant Lysinibacillus sphaericus Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Queuine tRNA-ribosyltransferase (tgt)
MBS1133065-02 0.02 mg (Yeast)

Recombinant Lysinibacillus sphaericus Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Queuine tRNA-ribosyltransferase (tgt)
MBS1133065-03 0.1 mg (E-Coli)

Recombinant Lysinibacillus sphaericus Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details
Recombinant Lysinibacillus sphaericus Queuine tRNA-ribosyltransferase (tgt)
MBS1133065-04 0.1 mg (Yeast)

Recombinant Lysinibacillus sphaericus Queuine tRNA-ribosyltransferase (tgt)

Sign In for Pricing
View Details