Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parachlorella kessleri ADP, ATP carrier protein

This Recombinant Parachlorella kessleri ADP, ATP carrier protein spans the amino acid sequence from region 1-339.

Product Specifications

Product Name Alternative

ADP, ATP carrier protein, ADP/ATP translocase, Adenine nucleotide translocator, ANT

UniProt

P31692

Expression Region

1-339

Origin

Parachlorella kessleri (Green alga) (Chlorella kessleri)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSSALYQQAGLSGLLRASAMGPQTPFIASPKETQADPMAFVKDLLAGGTAGAISKTAVA PIERVKLLLQTQDSNPMIKSGQVPRYTGIVNCFVRVSSEQGVASFWRGNLANVVRYFPTQ AFNFAFKDTIKGLFPKYSPKTDFWRFFVVNLASGGLAGAGSLLIVYPLDFARTRLAADVG SGKSREFTGLVDCLSKVVKRGGPMALYQGFGVSVQGIIVYRGAYFGLYDTAKGVLFKDER TANFFAKWAVAQAVTAGAGVLSYPFDTVRRRLMMQSGGERQYNGTIDCWRKVAQQEGMKA FFKGAWSNVLRGAGGAFVLVLYDEIKKFINPNAVSSASE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pExpress-1-LMO4 Plasmid
PVT35413 2 µg

pExpress-1-LMO4 Plasmid

Sign In for Pricing
View Details
Fish MOSC Domain-Containing Protein 1, Mitochondrial (MOSC1) ELISA Kit
MBS9933010 Inquire

Fish MOSC Domain-Containing Protein 1, Mitochondrial (MOSC1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 7 Proline--tRNA ligase (proS), partial
MBS1215399 Inquire

Recombinant Actinobacillus pleuropneumoniae serotype 7 Proline--tRNA ligase (proS), partial

Sign In for Pricing
View Details
HMGB3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV701205 1.0 µg DNA

HMGB3P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
UDB11 Rabbit Polyclonal Antibody
MBS9517710-01 0.05 mL

UDB11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UDB11 Rabbit Polyclonal Antibody
MBS9517710-02 0.1 mL

UDB11 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details